DPCstruct | MC3324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3I4R5 | 117-188 | LFFCGDGVSDLSAAKHADLLFAKTMPSGHSDLQTFCQKQKINHLPFVDFNKVLEKLQEVVAGKTVDDILTEE |
| A0A0F8AW46 | 1-70 | MYAGDGVSDQCAARETDLLFAKIDRDLVTYCEREQIPFVNFRDWADIQATVQKVLEGKTNVKLEAKGRIY |
| A0A7R7VPG4 | 119-176 | None |
| F0X8A5 | 448-511 | None |
| A0A4S4LWX0 | 170-252 | None |
| A0A094GCR3 | 1-79 | None |
| A0A194VWL0 | 189-265 | None |
| A0A5N6G1N2 | 186-262 | None |
| A0A4Q2DQX4 | 149-212 | None |
| A0A4V3X984 | 74-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.