DPCstruct | MC33236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.62 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0341- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7VP14 | 1-67 | MTLPHVVRAQTFVSELKKVDVTKTKIPVVGGHSGVTIVPLLSQCQPKVQLSDGEIKALSETYSRDWN |
| A0A7S2FED8 | 25-98 | LDVVRAKTFYAAKAGVQVEKVDVPVIGGHAGITILPLFSQATPSAPLSDEDIDALTIRTQNGGTEVVEAKDGKG |
| A0A7J6RF62 | 883-956 | None |
| A0A447LIC1 | 150-210 | None |
| A0A2P8XRQ0 | 23-87 | None |
| A0A2I0IAY0 | 77-139 | None |
| K3XL70 | 174-248 | None |
| A0A078G8R7 | 93-159 | None |
| A0A183UMF5 | 176-249 | None |
| A0A1Y5IFZ3 | 65-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.