DPCstruct | MC33235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 173 ± 20 aa |
| Standard deviation of domain lengths | 20.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1WHC5 | 95-252 | DANCESAAILDYYRHQLDLFSNMCLNRQYLALNSLSPQLHIHLILKCMSQADLSYELRASFCRLMLHLHADRDPQEPVTPVKYARLW… |
| A0A6V7VGE5 | 3-212 | DYYKHQLELFAQLCQDQQYLAIDPPPERKLLNISQQLPVDLVIKCISDSRLPFDIRASFCRLMLHLHVVRGSPVPAVRHARLWRDIP… |
| A0A034VAR5 | 621-786 | None |
| A0A5J4P0A9 | 636-815 | None |
| J9EB48 | 3-179 | None |
| A0A0S7KI66 | 42-196 | None |
| A0A0M0JZL2 | 17-218 | None |
| A0A448XDV3 | 38-195 | None |
| A0A7J7KIA4 | 183-347 | None |
| A0A821JXQ6 | 521-758 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.