DPCstruct | MC33233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 41.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0143 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7VE81 | 1-89 | MWIKVININGEITSFSWIENYDKLRNAVNITFPGFLVHEAVQWSDFYKKWFFLPRFASNVSPKDVKGENYGTNLLLIADENFTKIEA… |
| A0A2S2QJA0 | 13-106 | VNNNPMWIKIINKFGHITHVNWVNNYIAIRKAANINFPGYMIHESCVWSQVHKRWFFLPRRSSSKQYNEDADEYMATNLLISASDNF… |
| D8M6R9 | 859-946 | None |
| A0A0V0TZW1 | 942-1035 | None |
| A0A0N4ZHE3 | 213-310 | None |
| A0A3Q0ITQ8 | 74-162 | None |
| A0A0S4JUI2 | 243-341 | None |
| A0A7S1W5R3 | 308-402 | None |
| A0A3P7EHT1 | 188-284 | None |
| A0A498MTL7 | 444-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.