DPCstruct | MC33232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 5.50 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04870 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7VDH0 | 1-79 | MLGDYEERKIATWEELNKKFNYKQRKELDQIGYSMLTRDQLKFLYGPKSPFNDSVTLERLLPLTETLTINQIIERDIKK |
| A0A2A2LVX2 | 431-508 | VLGRFEKKKIDTLEELNRRIDHQQMSSLNSSGYAVLTPDQIHLLYGPSSPFNDTRVIQHLLQIDRKKVPRLLEETIHK |
| A0A0N4VEH7 | 156-235 | None |
| A0A1I8BXU6 | 350-430 | None |
| A0A6V7X2I1 | 71-147 | None |
| A0A158PLD4 | 151-239 | None |
| A0A0B2VBP6 | 446-534 | None |
| A0A183C2V0 | 262-352 | None |
| A0A183CLD1 | 486-573 | None |
| A0A1I8B6I7 | 65-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.