DPCstruct | MC33231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 54.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7U1C6 | 195-278 | DNFSWNNGDIFGCGLIYPPTKIDEFPYIFFTQNGQIIGKAVLLKDNFDCFHPYIGLANCCLVEANFGNDLGNKPFIYNFKKHPV |
| A0A6V7VCV2 | 2-88 | IDLDNNDIFGCGLVYPPTIKLDGEKKFPYMFFTLNGKQIGKGVLLIDNFYSYKPRVYLNCCSIETNFGKDLESKPFKYDISKHSVLK |
| A0A6V7TTH1 | 3-90 | None |
| A0A1I8C0K6 | 52-127 | None |
| A0A6V7XST3 | 117-200 | None |
| A0A6V7XCE8 | 144-226 | None |
| A0A6V7X2H2 | 2-74 | None |
| A0A6V7WPE9 | 38-114 | None |
| A0A6V7WGS1 | 209-290 | None |
| A0A6V7WAL3 | 33-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.