DPCstruct | MC33229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 137 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 29.37 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0226- PF12414 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9Q3R2 | 228-352 | MPTYPGVVYQDGFYGAADLYVRCPAAAAVVISPLSAEREASSLKKVEEAYDTINMEISDLRTKLAIDYGPDWEFLFLNSQCYQLNVY… |
| A0A183CWV4 | 25-151 | DKDKPAFNEETKAIIKAFNICEYIAEAEEAKSKYEEIDKRHREIEDLIKDVDWYASTDVGDDAAWASLKGKCIEMNENEYTYKLCLF… |
| A0A438JVV8 | 240-381 | None |
| A0A7S2RLX4 | 138-291 | None |
| A0A812B3B8 | 278-402 | None |
| A0A3P8FNL6 | 89-211 | None |
| A0A2I4B543 | 371-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.