DPCstruct | MC33224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 255 ± 24 aa |
| Standard deviation of domain lengths | 23.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812RIG0 | 1-236 | MLLVVDERIPGTSRERALVLFYRCTAGTSRESDDFADVCRLFKSTARPVDTELAGRKPGYPESYFARFPLHEDALRLVIGKLQTGDV… |
| A0A2R7WGQ0 | 79-305 | LFILEIYHTSPIRERLVVAYSRYNITVGTLDHVCQLIRSTGFTNSILGKKPSNYPQDLFRRIQANEKVVNLVIGKLRTEDIYHQQKV… |
| A0A0A9DY79 | 2-248 | None |
| A0A200QGX5 | 149-435 | None |
| A0A0B1T8R3 | 137-340 | None |
| A0A8B6HK75 | 2-232 | None |
| A0A058Z0P3 | 144-413 | None |
| K3YCJ5 | 145-428 | None |
| A0A6V7VKZ5 | 137-374 | None |
| A0A811QHL5 | 33-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.