DPCstruct | MC33223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 353 ± 21 aa |
| Standard deviation of domain lengths | 21.36 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.84 |
| Pfam Score | 89.24 |
| Assigned Pfam label(s) | PF14666- CL0542- PF14664 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512UIR2 | 1-363 | MKDTSFKALVAGTKLLAIKDFDEWNWSLLSQLFQGPLRNPVRFIELQEKYPKFLKTFVSFLRPFKYRFSSVPIAASSKYPKIRKPKN… |
| A0A2R7WFG5 | 1-325 | MLATWFLGPVLWGEAPLLCNLVDRSGLTEFMRHSDTLKKTTDSNKRLFVRRLVNFVLPVTGQYGRKEIGSDRKSSTKLTLAALSLFS… |
| B4I736 | 333-667 | None |
| A0A7G2CLR6 | 227-574 | None |
| A0A4Y9ZL48 | 587-916 | None |
| U7Q2K3 | 677-1024 | None |
| G0QUZ5 | 184-541 | None |
| A0A4D5RVK5 | 90-435 | None |
| Q4DDE7 | 599-966 | None |
| A0A0D2GW13 | 680-1036 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.