DPCstruct | MC33221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 116 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4K3J2 | 84-203 | FLSTKLLLGTTTTESFLDFNNQDIQYGIEEDQRNRVLRTYVRNAYIYHLNEIFSTVRNEYTDWEKPIQHPINIRDSTLEALSDAHTV… |
| A0A834I257 | 172-287 | EVMLGITTTESYGDFNANDIQYGFEEDQRNRILRTYIRNTYVYHLNEIFSAVRNEYTDWDKPIPHPINIRDSTMEALSDGHTVAPLV… |
| A0A835G8Y4 | 135-251 | None |
| A0A6H5I2U8 | 1065-1169 | None |
| A0A132A4I5 | 100-224 | None |
| A0A3Q0JLG7 | 108-226 | None |
| A0A5B7IYR1 | 245-365 | None |
| T1JP51 | 216-332 | None |
| W5JRC0 | 277-388 | None |
| A0A3Q0INJ2 | 166-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.