DPCstruct | MC33219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 240 ± 44 aa |
| Standard deviation of domain lengths | 44.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194RJL1 | 11-255 | IPRRLSEAQSQGWAKTARPSGPLPSLVMYCADDRMMCALYDPEGIVAGLQIAIAQIDISGSTFNWNTQGFVEWTATTADGTTLKYWA… |
| A0A2R7W9Q1 | 8-245 | LGVVIFALCINGLVAQRPYNDLRARYTTDPSQGFYEIPTNTSNPLIQNYVPTPADPDFNLPLNFYCYPDDPRVCFLYDFNGNIAGVQ… |
| A0A6C1PR06 | 8-220 | None |
| A0A7M5V0C7 | 1-198 | None |
| A0A7E5W261 | 309-492 | None |
| A0A815TDJ1 | 5-164 | None |
| A0A5E4PQQ3 | 372-643 | None |
| A0A3S0ZLD3 | 36-306 | None |
| A0A813V5A6 | 19-200 | None |
| D2VXE3 | 464-717 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.