DPCstruct | MC33217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 638 ± 102 aa |
| Standard deviation of domain lengths | 102.04 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.98 |
| Pfam Score | 76.57 |
| Assigned Pfam label(s) | CL0020- CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0XPV2 | 1-649 | LVGGQFDLEMNFIIQEGESIICMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVL… |
| A0A2R7W6X8 | 1-730 | MPPSRRISAFLGERRYSQIIHNELCHLALDLIEFSHREDKWYKESIYSLHKISSILRDNQENCIILANTGFTFNLLEKFGVLLSQDS… |
| Q19317 | 172-820 | None |
| A0A498P102 | 2-449 | None |
| A0A821HSE9 | 2-459 | None |
| T1GUW5 | 2-785 | None |
| A2DG77 | 704-1142 | None |
| A0A0V0XHR6 | 90-759 | None |
| A0A495Z3Q0 | 304-816 | None |
| A0A821TIY8 | 62-771 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.