DPCstruct | MC33216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 138 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 68.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.34 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF16876- CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2YZF3 | 89-221 | SPHASDFDSGTDSQTQDDQTYGPCLNDEVMMSLCGLPSASTEPQSDKFQEKLVTYDQFAQNAVSILNDPNLVVKFGDQYLTWQNAVP… |
| S4RMV4 | 286-418 | SPSHSPQSVGSGAADSGTECLSDSAQGDASTVALSLCGGLAESCNISQEKFEAHRVSFQQFLENPALIDDLNLVVLIGNKYYNWAVA… |
| A0A6F9CM81 | 508-660 | None |
| A0A834DPF8 | 4-135 | None |
| A0A445J0V8 | 106-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.