DPCstruct | MC33214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 259 ± 50 aa |
| Standard deviation of domain lengths | 50.14 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K6QZ35 | 173-468 | LKHKSFLEELLFWTIKYEFPQKMVTFLLNMLPDQEYKVAFTKTFVQHYAFIMKTLKKSHESDTMSNRIVHISVQLFSNEELARQVTE… |
| A0A2R7W4C1 | 17-245 | EELVFWTVKFEFPQKVVCFLLNMLPDPDYKEALTQAFVLHYSRISMMLEKSSDPDTLSNRVVHVSVQLFSNKDLALRMSDQLSLLHV… |
| A0A3Q0E026 | 235-529 | None |
| A0A7J6RD68 | 531-941 | None |
| A0A7J6RX73 | 112-367 | None |
| A0A5K4F7R9 | 288-507 | None |
| A0A556TRA1 | 232-581 | None |
| A0A183M0A9 | 2-243 | None |
| E9FUZ5 | 153-377 | None |
| A0A2K1IMR2 | 21-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.