DPCstruct | MC33213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 397 ± 42 aa |
| Standard deviation of domain lengths | 42.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14776 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7W325 | 1-387 | MSMKHNLVKDMLCVIAHGTSTARASAAKLLFYYWPTFNSSLFERKGIPPKFTNWKPFLCQRDMCPNSGTAEAAKVCYDHCISITFAT… |
| A0A2J7QGH8 | 1-329 | MCPNAGNAEAAKVCYDHCISITFASDSPPPLYLCIECANEIHREHPNQMFFDILHPMQQVSMTCENKNCRASDKYAVSICFSTECAS… |
| A0A7R8X9K5 | 1-490 | None |
| E2BRI3 | 114-564 | None |
| A0A182IZ53 | 22-417 | None |
| A0A0N5CRZ3 | 14-403 | None |
| A0A182TXS6 | 17-385 | None |
| A0A7R8VFI2 | 40-421 | None |
| A0A1V9XB99 | 2-400 | None |
| A0A368HAJ2 | 22-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.