DPCstruct | MC3321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.95 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0040- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1HPG0 | 1-105 | MRASIKWLKDYVAFTDSPEVLAEKLTMAGIPVACVEYLGKNIERVITGKIKEICKHPAADRLSVCRVNTGREELTIVTGATNVQEGQ… |
| E4LDB0 | 1-105 | MKASLQWMNEYVPVDMNRPAQELADELTQAGIPVEDVIPMDNGIKKIYTGKIVEITKHPDADKLQVCQVECLTEEGEPVTKQIVTAA… |
| A0A2E9X1Q5 | 217-323 | None |
| A0A812YTP3 | 452-540 | None |
| A0A7V6GNP8 | 3-100 | None |
| A0A6J4KSX3 | 48-154 | None |
| A0A538NKT8 | 1-108 | None |
| A0A538B027 | 1-116 | None |
| A0A419IIW9 | 194-279 | None |
| A0A2N2C157 | 85-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.