DPCstruct | MC33207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 19 aa |
| Standard deviation of domain lengths | 18.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7VYS8 | 9-145 | DCSSVASPSWHYHLVHNITSKGVQFFPQLDTVPEEILKKLFLNPSEVLIMKDYIMAHWSPTSNLKPLLNCRDDSWRQYNVLGQVVNV… |
| A0A2R2MM83 | 999-1124 | QMVYGVGPKGIYLTNPLELVPEETMLAQLCCESLLLIRREDIVKRWSVDCDLRPLLTQADPRWRTLNVLGQVINVIREEFTPHVPPS… |
| A0A0L8I7A7 | 1-128 | None |
| F4W518 | 918-1042 | None |
| A0A7J5Z8P7 | 90-198 | None |
| A0A7M7LTL2 | 115-283 | None |
| A0A4C1XKD0 | 34-169 | None |
| A0A0C9R8N7 | 593-717 | None |
| A0A6P5A693 | 183-346 | None |
| K1QTG6 | 875-1002 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.