DPCstruct | MC33206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 5.05 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7VX89 | 12-88 | TMEALMESDLLRRAEIMLQQAGKLGCRSFVTPADVVNGVYKLNLAFVANLFNNHPGLEKPEGGIEGLENLEETREEK |
| A0A2A2JW08 | 188-268 | IAPSGTGVSLAPLHVQGNVNRAGAMLDEAEKLDCREFVTPNDVATGNYKLNLAFVANLFNKHPNLPGPGADEIVEEVIQET |
| A0A4Z2HJM5 | 43-133 | None |
| A0A3P6TUK5 | 17-93 | None |
| A0A068Y5K4 | 164-251 | None |
| A0A6I9NBS2 | 1-75 | None |
| A0A2G8L3I6 | 1-82 | None |
| A0A3P8I3I8 | 7-80 | None |
| A0A0R3W065 | 7-83 | None |
| A0A1X7VVY2 | 11-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.