DPCstruct | MC33205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.58 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0143- CL0353 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7VVU0 | 2-100 | STEMYNEETDESQGTNILLLADEDFKNIEARTIGEVIPTHGFSTFKFIPGTNDEVIVALKTVEFKGKIASYIMAFTIYGKILMGETK… |
| A0A2S2QJA0 | 67-173 | WFFLPRRSSSKQYNEDADEYMATNLLISASDNFKDIKVVHVGEIIPTHGYSSFKFLPGTNDRIIVALKSEEVGSETASYITAFNIDG… |
| A0A498MTL7 | 492-593 | None |
| A0A0V0TZW1 | 996-1103 | None |
| A0A0N4ZHE3 | 267-370 | None |
| A0A2G8LBG5 | 37-157 | None |
| A0A7R9WMH8 | 16-139 | None |
| H0YYC0 | 291-388 | None |
| A0A4Z2EP16 | 53-173 | None |
| A0A5E4C106 | 92-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.