DPCstruct | MC33201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 7.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.89 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0266- CL0632 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820FZQ2 | 2-104 | DYLEKELGLRKFFSQTLLDSQKPRVLRKYIKACLKKYEGLAEEECVKRFCFLLKEVWNWEQEIFTCNLGAEWAVPISLVLGPSDGIS… |
| A0A2R7VRS8 | 1-87 | MNKFFPQSIVESQKPKSLRKLIQSNFKKFSQWSDKDVVLRYLKVIRSILHFGEERFQCALGSGWSIPVELVIGPEFGISYVSHRATA |
| A0A811VAL0 | 192-303 | None |
| A0A2S2Q285 | 307-413 | None |
| A0A5E4D292 | 5-94 | None |
| A0A4W5QTT0 | 188-288 | None |
| A0A0M4E7E7 | 200-304 | None |
| A0A4Z2IZB4 | 13-113 | None |
| B8A418 | 199-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.