DPCstruct | MC332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 62 ± 8 aa |
| Standard deviation of domain lengths | 7.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183GWA8 | 34-100 | NSDVTRGHAGVRAQAMDPEGNLVDDFVFDSGTGPLSKMVMHVRNAPSPGATSSLAIAQMITKEATTR |
| A0A060YQ90 | 21-90 | LSLSDVLRGPAGVRAQALDRDGNLVDDFVFDVGVGDVGSRVLHVRNAPSPAATSSLAIAEMVADEVERRF |
| A0A3D2JMX9 | 48-120 | None |
| A0A7V4M6K6 | 2-64 | None |
| A0A7Y3MK57 | 74-133 | None |
| S4N2N6 | 1-58 | None |
| A0A0K2Y0X8 | 15-70 | None |
| A0A0K2XW66 | 46-100 | None |
| A0A7H4ME13 | 3-63 | None |
| A0A5J4K901 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.