DPCstruct | MC33193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 177 ± 25 aa |
| Standard deviation of domain lengths | 25.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF12789- PF03406 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4AEK3 | 20-205 | CPKTKAENVTESAAKRFVSDTEKASWNGKQTALGFTPENASKKGTANGYPELDASGKVPASQLPSYVDDVLEYANQAAFPSSGETGK… |
| A0A1Y4AU74 | 12-180 | WANVKSLFNTHTTNKNNPHGVTKSQIGLANVENKSSATIRGEMTSDNVTDALGYTPLDAAKKGAASGVAELDATGKVPSAQLPSYVD… |
| A0A1V3N2D5 | 51-235 | None |
| A0A1M7CNN7 | 5-132 | None |
| A0A4V2RNH0 | 191-381 | None |
| A0A5D8YPK8 | 33-216 | None |
| A0A6A8BEA8 | 1-216 | None |
| A0A521AEM6 | 136-299 | None |
| A0A1C0V8F1 | 128-307 | None |
| A0A560C055 | 343-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.