DPCstruct | MC3319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 510 ± 40 aa |
| Standard deviation of domain lengths | 39.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4K8H7 | 1-507 | MGAGNDKVVGHSQKRNIFDIGDGIKNFKGGNESDTFIFTGTIVPDKPSVLDGVKGFDFLIANTKPSQSQGGYYIHLKEEYFGFTDSS… |
| C4K469 | 357-866 | NDHINVNEDDDNNVTVKKISSDDSDIAQEESMALFDLGEGDDIAVGYLQKRNIFKISAGSKQYTGGDKADIFYLSKPDLLAQASYFN… |
| A0A2Z5UVY5 | 174-748 | None |
| A0A2U8I3N6 | 172-734 | None |
| A0A380QCF2 | 554-1037 | None |
| G2H1C6 | 549-1036 | None |
| B1TF69 | 1-511 | None |
| A0A5F1B6S8 | 30-498 | None |
| A0A6L2ZPJ0 | 457-1004 | None |
| A0A533ZXT6 | 140-583 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.