DPCstruct | MC33187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 225 ± 38 aa |
| Standard deviation of domain lengths | 37.99 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 17.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0NSY1 | 1-150 | MRHVEEIDDDRSDSEGFYDYCTFLKSIHNYTIVLEDPGFVFLRSEIMEELEKPETYGLSTPESKIAEAIDYGIKIVTKSIRPDDGRS… |
| G0MMU2 | 1-218 | MDDYEYNPREDNLPESSPIDNQLEEPKPQATEEHNTNNEVQNTDRRSDTVAPEPKPEKESLTLQKDTISTPQTNGNEFISVESHIRC… |
| G5EEE4 | 1303-1556 | None |
| A0A2G5TRI1 | 71-337 | None |
| O76580 | 233-527 | None |
| G0P3E7 | 604-853 | None |
| G0P0Z7 | 357-623 | None |
| G0NIL0 | 28-282 | None |
| G0MRD3 | 7-228 | None |
| G0NGG3 | 315-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.