DPCstruct | MC33185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 261 ± 44 aa |
| Standard deviation of domain lengths | 43.97 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0MJR5 | 18-249 | VIGLLLILLWIHFSNRKIGRITKTPTIVFPGHKFTVNESHEGVRFLCGYTEHNKKKKWNEAELTEKLESLLKMVGYSFVYKDARVIM… |
| A0A2G5VSQ2 | 15-281 | IDGANKQCAMEHGYPVASIPYCPKILAQGTYKRILFNAQNAPKVLLIMAPDGAELVDPKSLAFIQEQLRNAYQEQPTLMQHLEDPFP… |
| B3WFY9 | 46-304 | None |
| A0A2G5TZP3 | 18-319 | None |
| A0A2G5TZR4 | 1-249 | None |
| A0A2H2IMC0 | 8-270 | None |
| G0NSM1 | 39-305 | None |
| G0NFM7 | 4-331 | None |
| G0NFM6 | 301-578 | None |
| G0NFN2 | 52-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.