DPCstruct | MC33184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 391 ± 60 aa |
| Standard deviation of domain lengths | 59.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N4V3I9 | 257-598 | AVKRMQNNRAPMQSLSHFIVALAANRIIRGWNQTGQKHAGEPDIVKAFIITNPPLLWSLVSATYIYLFAQITRRLSGLHLAASSIVS… |
| G0MIJ0 | 43-353 | LLIFAGIMLILRVEPLFHRCREEEIGCEMYWMARQAASLSRDAQVVRLLFALISLCAANFSVFKFYYGHQSHQLKSGSISTSNGLFI… |
| A0A1V9YKV2 | 717-1083 | None |
| D8RG09 | 429-852 | None |
| A0A7J7GHS2 | 462-873 | None |
| A0A5K3EVM0 | 2-315 | None |
| A0A674IT75 | 398-914 | None |
| A0A7C9AA12 | 13-372 | None |
| A0A6G1M192 | 382-788 | None |
| A0A1Y3ELN6 | 1-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.