DPCstruct | MC33178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 145 ± 15 aa |
| Standard deviation of domain lengths | 14.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09834 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0JPF1 | 1-165 | MATRAIPIDALPARPVRSSRRFLAKAISWRIVGTLDTFILSVLLLTFLGPWLGIQEHSRGHTGTAGLIALTEVATKIALFYVHEWLW… |
| A0A6B2KM50 | 2-123 | TKTLTFAATHFTVAFGVAYLLTGSFAISGAMALAEPLTNTVTYHFHDKAWARLLARTPLRHVELAKTATFALCHFTVAFGLGWLLTG… |
| A0A0F9CDR3 | 1-131 | None |
| B8C4G0 | 830-973 | None |
| A0A7S2UXG1 | 68-222 | None |
| A0A2M7KBM5 | 1-150 | None |
| A0A7S3JWE3 | 106-250 | None |
| A0A7W2GS10 | 1-166 | None |
| A0A4R8DFF7 | 2-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.