DPCstruct | MC33175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 143 ± 13 aa |
| Standard deviation of domain lengths | 13.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016QKP6 | 4-133 | GVHLDAWAHHRFALESFFTPWHGLLYSGFALLALLLALLLAAAAVRGGGLRPSAMPGGYGPSLVGAGLFALGGVGDLLWHTLFGIEV… |
| A0A7X0RTU2 | 16-154 | VTILLGLWLIIGVFIDGFAHGHLDSTLETFFTPWHAILYSGYIASASWLVWLIYRNHKNGVTGLKNMLPNGYGLGFIGVIIFAIGGV… |
| A0A1Q6Z8E4 | 28-190 | None |
| A0A538KN72 | 6-145 | None |
| A0A5J4KFN3 | 23-155 | None |
| A0A7V3BLL4 | 35-154 | None |
| A0A1F7NL17 | 6-160 | None |
| A0A2E5QDU6 | 52-199 | None |
| A0A060HKJ6 | 1-156 | None |
| A0A4P6K4N9 | 17-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.