DPCstruct | MC33172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 155 ± 17 aa |
| Standard deviation of domain lengths | 17.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A374EEE2 | 1-137 | MTQVNVKYNPYKLETQIKINGKAIQNDSALYKLVKEKRLQEWVGNFPKMLVDDQNTVELKVEFNGMALDWDDFEDAFKTAKSDGVIR… |
| A0A1Y4IGK8 | 1-149 | MKKIDMIYNPYTEKAGLTIDGSWHYGGDGRLKDFFVGKSIEKWLPRRTVSYQRWDGILPELMEYLNDDELLIRFCGTEPDYRRVEKE… |
| A0A7C6P090 | 15-186 | None |
| A0A7X6S2D4 | 4-166 | None |
| A0A3E2W507 | 2-173 | None |
| A0A062XDI0 | 1-162 | None |
| A0A1I3Y9A7 | 1-146 | None |
| Q1QCA0 | 1-147 | None |
| A0A2Z4IAU9 | 2-143 | None |
| A0A1G6EDG1 | 125-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.