DPCstruct | MC33170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 156 ± 21 aa |
| Standard deviation of domain lengths | 20.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20296 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5M1G4 | 31-201 | LHRVLIRALGPGVAALPSDDALTRKPLILDLASPLPPRLRFYVYQATQHPSERQQGTFKIQLSVGVTRDGQPASPKEKRRWFDRADN… |
| R5J724 | 4-142 | SIVSHTDVSMWPFVFSITEPIPMTFALYIYDNKNPAGGRPNLEYKFNIYVPGQKRGQYSSFDYTEGFPLMVSYSEDYDVYIIYDAEK… |
| A0A6B9F4W9 | 11-179 | None |
| A0A329AS01 | 8-153 | None |
| A0A6I2MSX5 | 12-156 | None |
| A0A1H6M2G7 | 27-212 | None |
| A0A346P9H5 | 19-166 | None |
| A0A4U6CHE6 | 113-263 | None |
| A0A2N1QJI7 | 20-180 | None |
| A0A3A8JCZ2 | 133-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.