DPCstruct | MC3317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 181 ± 34 aa |
| Standard deviation of domain lengths | 33.75 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1C9P2 | 2-124 | VTRRYEIEVQGSEDGRTWKIYEFKWKPGNLKISPRPAAPYQPRLDWQLWFAALGEVKHNPWFTRFIYRLMENSPEVVKLMKNNPFPD… |
| A0A813D598 | 632-813 | IPVRLELADYWPAGARVANALQPLRLSSCYTMFCLMPQERFVLVVQGSEDGSDWRDYELLGPPAAVDRAPTFFAPYHDYLGFRLWFA… |
| A0A2S8BHL7 | 3-145 | None |
| A0A654HRP7 | 766-948 | None |
| A0A061RAX3 | 18-221 | None |
| A0A2B4S7Y5 | 426-626 | None |
| A0A7S1UZ59 | 10-183 | None |
| A0A835NHM2 | 42-148 | None |
| A0A183NDX4 | 260-424 | None |
| A0A6L5DMC9 | 126-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.