DPCstruct | MC33168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 275 |
|---|---|
| Mean domain length (aa) | 184 ± 34 aa |
| Standard deviation of domain lengths | 33.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.04 |
| Pfam Score | 76.73 |
| Assigned Pfam label(s) | CL0344- CL0404- CL0063- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A6P324 | 404-593 | APCHRTCPANIDIPTFLALEGHHKYFEAAGSISLDNPLPYVCGLVCPGPCESACLRGEMDQPISIRAMKAVAARHALADQGQYPRPE… |
| A0A2X3DLU0 | 111-308 | QVAEDILARGDADMVSMARPFLADAEFISKAQDDRADQINTCIGCNQACLDRIFVGKVTSCLVNPRACHETLMPVLPANAPKRLAVV… |
| A0A672Q2K2 | 51-224 | None |
| A0A0D0RHP1 | 22-243 | None |
| A0A848A5A6 | 116-305 | None |
| A0A1Y4TMG8 | 108-286 | None |
| A0A7R9PRJ3 | 14-196 | None |
| A0A2D6TD74 | 12-223 | None |
| A0A397EQC8 | 4-203 | None |
| A0A485JBS1 | 216-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.