DPCstruct | MC33166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 165 ± 27 aa |
| Standard deviation of domain lengths | 26.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5Z0U1 | 3-151 | ELEEFKKLLAKLSWIKKPKFLRIALNPLIPKPWTPYQFIPPSSILRLSHNINSYYKLAKESIFTSIESFNYKWAFAQAVIAQGDERI… |
| A0A7U9SRN1 | 56-255 | MLGLPMETEEDIKGIGELCNKIAALFYETVPKEKRTGRVQIVASTSFFIPKPFTPFQWAGQCTREEFLDKAYSTRAAIAGQLNQKSI… |
| R5VKV0 | 3-139 | None |
| A0A1C5EX18 | 3-174 | None |
| A0A6N2E747 | 527-734 | None |
| A0A3C0PCS4 | 256-447 | None |
| A0A1W9RMF0 | 384-544 | None |
| A0A7X6XWR6 | 125-286 | None |
| A0A843FLE8 | 2-109 | None |
| A0A1I7EXD8 | 583-763 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.