DPCstruct | MC33161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 266 ± 32 aa |
| Standard deviation of domain lengths | 32.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2X9R0 | 29-349 | RPVDDYLGRLRAGRTLEGGPGSHRWPVLDVKVVNNTAEAVLLHEAVLQVRSSEPDLRAVPVLFCRGTDIVLRNDGWGRMEDCALTFS… |
| F7ZBN8 | 37-289 | FPDFEYLNFLKEEKSVVGVHFWWSPFEFVLPEMAIRIANDTQDQVFVDQAKFYVRSSEIDYKPVPVFELLTRIDSIHIINEGWGPME… |
| A0A0F4IVM7 | 5-262 | None |
| A0A833G567 | 105-434 | None |
| A0A257M561 | 103-358 | None |
| A0A7G9YN04 | 6-221 | None |
| A0A0Q5TWP7 | 231-515 | None |
| A0A2E0ILV6 | 140-408 | None |
| A0A1M5GRI5 | 38-316 | None |
| A0A351TM05 | 245-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.