DPCstruct | MC33157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 40.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I9P5K4 | 256-343 | LNAEQIKERTDELLKSIPEVIENGTLLKDDLGRVSIQLNDVKVGLTNQWFGNDLKNHLIVTSYERDKKVLRELETRSPLSNDYKGNSN |
| A0A4Y4W424 | 4-103 | IKTIPEVIDKGVKVERNGRVAIEYENIRVGLKDNWKGEKLPNHWVITGYEKRLENSESLYTSPPITKSEILPLNSVENNPTPKPLTS… |
| K2KT25 | 334-420 | None |
| I9ZQM9 | 256-353 | None |
| J0Q7G8 | 11-89 | None |
| K2KC36 | 184-280 | None |
| J0GP04 | 16-118 | None |
| A0A293TS28 | 156-256 | None |
| A0A438YNP2 | 283-385 | None |
| Q8VTC6 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.