DPCstruct | MC33154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 145 ± 13 aa |
| Standard deviation of domain lengths | 12.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 54.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6N371 | 39-182 | MTDGLSYNYNCQVIPPEALKTIIRRPILASEASEADVDSGRLSGLVFVSERDMNLETLHIALRFTDKVKVLSFADIYGTFSGVRMED… |
| A0A2P5EAI2 | 1-146 | MTDRRSYNYSGQFIPPAALKTILKHPKLASKFGSEADVDAGRLSGMVFVSERRDQLETLHIAIRSIENQANVNIFSFADVFGTFNGV… |
| A0A453MV84 | 156-307 | None |
| A0A2P5E2Q9 | 1-116 | None |
| A0A7J6HPG1 | 46-205 | None |
| A0A2T8I542 | 39-190 | None |
| A0A6A6N218 | 250-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.