DPCstruct | MC3315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287VUJ2 | 85-154 | SFVDILEIRYSSPLFRLSTANDIKQRVRFHNTGPSLVPGVIVMGIEDARGESPEMAQLDTNFSYVVTVFN |
| A0A813CSL1 | 9-87 | FCELLAIRKSTALFGLREAEDILTKVKFPGCGRHQVPGVVMMEVTNGRAAAGPNAGLPLCDQYARVVVVFSSRPSPVRI |
| A0A6A2YRU1 | 114-198 | None |
| A0A287VUJ7 | 17-92 | None |
| A0A6N8K8V6 | 42-131 | None |
| A0A656SJC1 | 178-258 | None |
| A0A6S5P805 | 53-125 | None |
| K6ZUG7 | 2-87 | None |
| A0A2N7BSY3 | 99-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.