DPCstruct | MC3314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 144 ± 17 aa |
| Standard deviation of domain lengths | 16.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2J7V8 | 2-136 | ENKLKHLEFIQNIITRMNTNSFQIKGMSITIVVALLALTATDFNILFASIVYFSLLIFWGLDAYYLSQEKGYRQLYDEIRNINENDI… |
| A0A813CMW5 | 4-133 | RKTEHLQMIQGVVSRLSTNSFLLKGWSVVLVSALFGLSTQVENRTPFLALAYFPALAFWILDAYFLSQERRFRALFDHVRMQLEDKI… |
| A0A2T5GJ95 | 1-179 | None |
| A0A4Q7HWJ4 | 5-156 | None |
| A0A5E8H1N9 | 1-153 | None |
| A0A7X1P009 | 31-165 | None |
| A0A202E1T9 | 3-124 | None |
| A0A1F5EJV0 | 9-130 | None |
| A0A7L7E803 | 14-150 | None |
| A0A1Q3MHV7 | 5-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.