DPCstruct | MC33139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 117 ± 17 aa |
| Standard deviation of domain lengths | 17.39 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8WXY3 | 1-122 | MWSVNLQHFLDASGSTATTPPEARELADHFGAIVAAVTLDFTGKLVEIDAVTCRNTKVANCNGKIVACLGDELTSVDWYCDKCDDSG… |
| A0A431PFU1 | 1-96 | MYVISLDHYLDAKGAIAVDKGPGRKIAEFATAAVAYASNKKRPDDAPRPTCFKCRKPKDSAVDISVTETGLVVWCCHACGNEGQISN… |
| D6SM23 | 1-146 | None |
| A0A2S9XTN5 | 15-148 | None |
| A0A5Q4FKU2 | 1-143 | None |
| A0A2W4KE29 | 1-111 | None |
| A0A7V1EF09 | 3-119 | None |
| E6Q3C4 | 1-103 | None |
| A0A6N7C7U5 | 1-103 | None |
| A0A0K2SNU2 | 6-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.