DPCstruct | MC33135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 147 ± 28 aa |
| Standard deviation of domain lengths | 27.82 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12612 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9I3D2 | 27-165 | LNHFLPEVTSNNQQARVGNALALGSMPRFLLTVSLPKVIQQLCTCALITDKTLQWAESRKNALTALSLVCTTVGIAPSSPGGVDQVT… |
| A0A0R3SVA3 | 3-137 | LGHLLDSLNARTESSQIGYLGVLARAPGFLFVDDVETSLREISASSRPVKLTLLWGNARQQALTTLTEVTKHIGVTDGKISDAQLHS… |
| A0A067K1Y3 | 30-185 | None |
| A0A418B7G3 | 3-173 | None |
| E9I2I4 | 404-544 | None |
| A0A7M3RXI3 | 547-714 | None |
| E9HSQ0 | 211-399 | None |
| A0A452YM37 | 2-157 | None |
| E9I5V0 | 4-174 | None |
| A0A0K8UQ66 | 3-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.