DPCstruct | MC33133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 242 ± 44 aa |
| Standard deviation of domain lengths | 43.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.38 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0023- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F7S639 | 91-338 | IKKAKTLKATKKRLKQRFWTEIYDGAKLFYLSGIINGRYPDTEIQNLSRFIGVMKFRPLIFRNAHPYMLADRMEDLTPREDIRANPK… |
| E9I054 | 63-274 | REKNCCTSGQLHGTYPKNEIKNLGRFISVMKFLPLLWRSTHPYVLVDRLEDMTPPSRLHENPKCNRDICLYGFARGVHLRNHCPIHI… |
| A7AMX6 | 196-419 | None |
| A0A0B1PJ11 | 423-783 | None |
| A0A2V2VWE4 | 196-434 | None |
| A0A7N8XM78 | 182-400 | None |
| A0A0A2V7B0 | 149-409 | None |
| A0A6V7XUR2 | 230-420 | None |
| A0A453I5S7 | 39-341 | None |
| E4XZS0 | 4-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.