DPCstruct | MC33132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 200 ± 37 aa |
| Standard deviation of domain lengths | 36.81 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.88 |
| Pfam Score | 81.03 |
| Assigned Pfam label(s) | CL0123- CL0028- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9HXV7 | 44-225 | MTYSVGFRAPSAAEVLTHFTDFLGQFLPDEERYSDADAQPTSDPTQIQRDALDRLKALLTEHMSDERLLMTWFGQFMTEPKYPELIA… |
| W1DKL3 | 24-201 | LNYSVGYRAPNARELFSGFADYVLQRELGSQRYADPDVPSRDHPADILPTELDRLREMMLGLINQPEHFKQWFGEFITQSRHELDVA… |
| A0A815UWJ0 | 52-329 | None |
| A0A498NKK1 | 216-424 | None |
| A0A7S2XQF0 | 17-269 | None |
| A0A1D2N3X4 | 551-793 | None |
| A0A0N1GUS0 | 15-177 | None |
| A0A383YMU0 | 87-340 | None |
| A0A2S9PX26 | 119-287 | None |
| A0A818DNT9 | 2-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.