DPCstruct | MC3313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 187 |
|---|---|
| Mean domain length (aa) | 324 ± 62 aa |
| Standard deviation of domain lengths | 61.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.60 |
| Pfam Score | 90.98 |
| Assigned Pfam label(s) | CL0214- CL0184- PF13705- PF05739- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2Y820 | 13-322 | VSFILLVCAILRAFWYHVYFYRALNYFLVSKFSLLTLGNFVASLALCVGKGLQLLLLGSLRSREVEMLTYRTKETILETFLAMSIFR… |
| A0A813CK79 | 89-405 | GLRSSPVWQREDSPWLSGIEIRTSDLIRSLSHSHSWRAMEQQQPISRCRCAACRACEVLCDELVLRWLPTMGLNLPDPLPLLARTQA… |
| A0A1Q9ECN9 | 158-422 | None |
| A0A5K4EWW0 | 156-645 | None |
| A0A813FCI2 | 161-492 | None |
| A0A453PTV4 | 7-252 | None |
| Q5Z5F2 | 5-229 | None |
| A0A2K1QQA6 | 3-417 | None |
| A0A044UZ17 | 425-831 | None |
| A0A1Q9EBP5 | 33-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.