DPCstruct | MC33128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 166 ± 28 aa |
| Standard deviation of domain lengths | 27.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SGE6 | 2-120 | LEWFVDKDVATRALGSPPSLIEEHNVEIKPELIHEGVLDENVDVHLVRPFFTTDAWLCVTNVVQEKQKTHVYYCNCCQQDLENFPSI… |
| E9HSM2 | 34-203 | LHLTNVKRRMGKPRTTKRLDRYKYSPKQFLKKGNHEKVTMFLSWVTGNERAYYLLDSKENADIKDFRSTNLMSPALFENDVNSVLKS… |
| T1F053 | 186-342 | None |
| R7UNF5 | 59-247 | None |
| A0A2G8L1W9 | 37-170 | None |
| T1FJW7 | 128-254 | None |
| A0A6J2YBT4 | 85-270 | None |
| A0A3M7RSA5 | 174-326 | None |
| A0A814A0I8 | 249-433 | None |
| A0A814GU56 | 561-713 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.