DPCstruct | MC33127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 444 ± 54 aa |
| Standard deviation of domain lengths | 53.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 38.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9HPE2 | 6-436 | SEIPVMKDSLIQILIIGLSKEHLITAPDALELADQLLRRCAAVHNLGFFMPEADNQEIFDMVLRLTAYHYPKNIVLPQEYTPPNLAI… |
| A0A811WEY9 | 3-427 | GEEIPISPAEALDLFETLVRRLCALPTEQRPLTLEQPDQLPDYLFQLAQFQPADSVQLPAGYTVPPLAISALYWRCWCALVMLCAHS… |
| A0A6I9N5I5 | 81-584 | None |
| A0A0S7F6Z8 | 2-375 | None |
| A0A814E3U7 | 715-1110 | None |
| A0A0R4IJ75 | 642-1146 | None |
| A0A485NKH0 | 425-879 | None |
| A0A0S7FAC8 | 2-375 | None |
| A0A0D8XK10 | 63-449 | None |
| A0A3P4LTM5 | 482-990 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.