DPCstruct | MC33126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 450 ± 106 aa |
| Standard deviation of domain lengths | 106.11 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9HLM0 | 85-598 | RKKSESTEYYDASDLESEEWNEDAKNDRESLPSIRNQLFALIEKLGALLPRNWMDYLINELGGPQNVAEISNREARVVQKDNGQADR… |
| A0A5A9P9C1 | 2-284 | KKGMIDVGIFCREPRLGLNTEKDCTITKFLNRILGLEVYQQNSLFQYFTDNFDYLIEKDKKEGKYDMGILDLAPGNDEIHEETQEKF… |
| A0A212DT53 | 23-353 | None |
| T1PIV2 | 2-331 | None |
| A0A7R9VSP6 | 13-731 | None |
| A0A6L7LG99 | 49-565 | None |
| A0A452TH35 | 523-976 | None |
| A0A7R9KDN0 | 2-315 | None |
| A0A7M5XE02 | 518-1062 | None |
| E9HU11 | 2-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.