DPCstruct | MC33125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 203 ± 42 aa |
| Standard deviation of domain lengths | 42.45 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8GW73 | 21-221 | ILRSSDFEGCSVAQIAQLRQSIANLVISLIEENSPEAIIIAREVKDTLDKGALYRVMAECYEMQLNDGKEGGGLLRRILAKEDRKEL… |
| E9HLN3 | 78-235 | MDLVLDCCWPSPVMESRGESENAERILYNMNPRQLVDVACKAYHKKLVGGEEAASPKEVGLNIYILCHHLAQHNKELAALMKPPPVD… |
| A0A1I7WUH0 | 191-431 | None |
| A0A183NZC1 | 552-764 | None |
| A0A183LSJ4 | 444-652 | None |
| A0A1I8I4N5 | 6-204 | None |
| A0A384DLK4 | 4-182 | None |
| A0A820UJE2 | 593-782 | None |
| A0A2I0TIT1 | 110-317 | None |
| A0A183F856 | 6-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.