DPCstruct | MC33122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 355 ± 52 aa |
| Standard deviation of domain lengths | 51.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A671R0D6 | 32-360 | VYKKTARDLTDEMRSNCESLNGNRSNLEKHILKTLAEEEDFDKCMNYIDNPRDHFQSFIRDEVSRYITDKFSVNVLPKMKENIKLLQ… |
| E9HF58 | 138-481 | GAGSIQIIDYVVCVILSQAFEKEMVKKTSNRIRNERWLQDARFMHKHLDLHLVDLLEKKKISEVLEFIGNPKHLYDVVLGQLIAQKV… |
| A0A816R8R8 | 623-1004 | None |
| A0A1V9YU24 | 14-358 | None |
| S4RP40 | 524-764 | None |
| A0A7S3GBT8 | 95-405 | None |
| A0A498NTJ5 | 320-664 | None |
| A0A4W6FFN2 | 593-918 | None |
| F1R1W9 | 1201-1559 | None |
| S7PH71 | 756-1104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.