DPCstruct | MC33121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 214 ± 39 aa |
| Standard deviation of domain lengths | 39.40 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9HCN4 | 1-197 | MENRTTKLQGHASSSDDKKITLLSLHDDVFLEILSYLSYDEVAKLRLVGRHFNEVCQKILNKGFLSFQRYHSRCLKEVKAKLPRRES… |
| A0A0R3VXA0 | 1-165 | MQLLEMPSDCLRKIFSFLTFHEIALIRPVCRKFNSVAADLLKCEFCRLEQLVRDYRRELKVLLPRRESERRKHTLAGHADVLSAVET… |
| A0A6V7V9W7 | 55-321 | None |
| A0A4U1F9Z8 | 18-232 | None |
| A0A820LG52 | 4-172 | None |
| A0A182FI06 | 1-275 | None |
| A0A7R8XBE5 | 11-198 | None |
| A0A0N5D4E3 | 511-729 | None |
| Q16UZ5 | 6-251 | None |
| A0A1I8BZR0 | 598-849 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.