DPCstruct | MC33118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 402 |
|---|---|
| Mean domain length (aa) | 184 ± 46 aa |
| Standard deviation of domain lengths | 46.21 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.41 |
| Pfam Score | 98.94 |
| Assigned Pfam label(s) | PF16455- PF11022- CL0670- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7Q820 | 2-111 | MGLDLEAWLEDEQACELWPGIVDHMEWARLQHCPLGPARGLTLVFSAKESLFKALYPTVGRYFDFLDARWLTMTEQTLTFELKSALT… |
| A0A1Q7GUW4 | 14-188 | VEKDRRRFIAARAALRSIVGERIGVAPADVAFRYGSRGKPELEHASRAVRFNLSHSEDLCVIAVHDDREVGVDVERIRPLVDLDAVR… |
| A0A7T1HVU4 | 382-597 | None |
| A0A6A6L4Y7 | 383-593 | None |
| A0A6S8RXB0 | 122-341 | None |
| A0A7G6ABD5 | 2-100 | None |
| A0A7M3LQX0 | 39-233 | None |
| A0A534KFA6 | 222-381 | None |
| A0A2S7JF56 | 12-150 | None |
| A0A7S2MRD3 | 6-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.